PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp1016s0011.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 583aa    MW: 63782.2 Da    PI: 5.1741
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp1016s0011.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.2e-33172228259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+++k+ver++ d++++ei+Y+g+Hnh+
  Kaladp1016s0011.4.p 172 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEMRKQVERTH-DGQITEIVYKGNHNHP 228
                          7***************************************9.***************8 PP

2WRKY104.55.7e-33362420159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +d+k+v++tYeg+Hnhe
  Kaladp1016s0011.4.p 362 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPGCLVRKHVERAPDDNKCVVTTYEGKHNHE 420
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.512166230IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-29168230IPR003657WRKY domain
SuperFamilySSF1182906.28E-26168230IPR003657WRKY domain
SMARTSM007741.1E-36171229IPR003657WRKY domain
PfamPF031062.2E-26172228IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.2E-35347422IPR003657WRKY domain
PROSITE profilePS5081136.896357422IPR003657WRKY domain
SuperFamilySSF1182901.15E-28357422IPR003657WRKY domain
SMARTSM007746.0E-38362421IPR003657WRKY domain
PfamPF031065.1E-25363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MLLCCVVERQ PSPTTGSYYS PPFNQDLSFL TNSMAAPTAA GGYCDSLPFF HGSEHPAGEV  60
NNLHYFKHLE TQDLDGGFLN LPSQQLPIEF ELPVLSNEFI ASASIRNDYI DVDFLSPADL  120
SNAHTTLPPS QPNDHITSQR NDHMYIDGAA DHVMEEEKRA SSPPMGGMRT TEDGYNWRKY  180
GQKQVKGSEF PRSYYKCTHP NCEMRKQVER THDGQITEIV YKGNHNHPQP MPNRRLTPDS  240
AFAQNEMDAG EGCGGGTSRG KNEGLDRALS EPILTELSPT GREKRFSAFD SSEAAELASP  300
LHNHAAEDDE AVEENMADAN EVHNDATDLR RAEDCMVEPS MSSRGVREQK IVVEIETEVD  360
ILDDGYRWRK YGQKVVKGNP NPRSYYKCTT PGCLVRKHVE RAPDDNKCVV TTYEGKHNHE  420
VPAAKNSSNA SPNAGHLSSA HPVGQPSHMP LAGSAAITMP AQAQFQPPPF ESKPYMGNGF  480
SAHSLPGNFG NDVSFGASSM YPMLYGSFGL AASYPNIQRA GLSISRSPIL DSAAANPMTL  540
HYGFDNHRGG GVIQTAHPGD ENDPTRRGPK QDEANDEPAD DS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-35172423878Probable WRKY transcription factor 4
2lex_A5e-35172423878Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA18G47741.11e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-73WRKY family protein